PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g05740.2.p
Common NameBRADI_2g05740, LOC100835199
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 240aa    MW: 25894.1 Da    PI: 8.213
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g05740.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-161462148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      rg+W++eEd++l d+++++G+g +W t +++ g++R++k+c++rw++yl
  Bradi2g05740.2.p 14 RGPWSPEEDDKLRDYIQRHGTGgSWITFPKKAGLRRCGKSCRLRWLNYL 62
                      89*********************************************97 PP

2Myb_DNA-binding42.81.2e-1369111246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g +T eEd l+  +  +lG++ W++Ia+ +  +Rt++++k++w++
  Bradi2g05740.2.p  69 GGFTDEEDALIFSLYSKLGSK-WSLIASQLE-RRTDNDVKNHWNT 111
                       569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.128962IPR017930Myb domain
SuperFamilySSF466899.18E-2712109IPR009057Homeodomain-like
SMARTSM007171.2E-91364IPR001005SANT/Myb domain
PfamPF002495.7E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-231569IPR009057Homeodomain-like
CDDcd001676.99E-81662No hitNo description
PROSITE profilePS5129422.72663117IPR017930Myb domain
SMARTSM007176.1E-1267115IPR001005SANT/Myb domain
PfamPF002494.0E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-2270117IPR009057Homeodomain-like
CDDcd001673.46E-1071113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MGRAPCCDRA AVKRGPWSPE EDDKLRDYIQ RHGTGGSWIT FPKKAGLRRC GKSCRLRWLN  60
YLRPDIRHGG FTDEEDALIF SLYSKLGSKW SLIASQLERR TDNDVKNHWN TKLKKRLAAF  120
SSPPSSSSSF LPAPAPMAVA VAHPLALAVP TVKAETYAYD DFMAPPAALH VFDHPFGNGA  180
DQPGSTTSAS AASSMSNWSS AADNAGAADG FFADFCNAGA ADQFLGGFYY PLDPTLSLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-24141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519081e-148JF951908.1 Triticum aestivum clone TaMYB25 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564735.11e-177PREDICTED: transcription factor RAX1-like
SwissprotQ9FG683e-69RAX1_ARATH; Transcription factor RAX1
TrEMBLI1HCW41e-177I1HCW4_BRADI; Uncharacterized protein
STRINGBRADI2G05740.11e-177(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.11e-65MYB family protein